powered by:
Protein Alignment Eip63F-1 and cabp7b
DIOPT Version :9
Sequence 1: | NP_524902.2 |
Gene: | Eip63F-1 / 47878 |
FlyBaseID: | FBgn0004910 |
Length: | 193 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_683885.1 |
Gene: | cabp7b / 556082 |
ZFINID: | ZDB-GENE-060526-366 |
Length: | 213 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 34/72 - (47%) |
Similarity: | 49/72 - (68%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 PVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINY 185
||...:|..|::..||:||||||||||::.||..||..:|...||.:||.::...|:|.||::::
Zfish 27 PVSLPEDEVEEIREAFKVFDRDGNGFISKQELGVAMRSLGYMPNEVELEVIIQRLDMDGDGQVDF 91
Fly 186 EEFTRLL 192
|||..||
Zfish 92 EEFVALL 98
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.