DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and cetn1

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001017149.1 Gene:cetn1 / 549903 XenbaseID:XB-GENE-967617 Length:172 Species:Xenopus tropicalis


Alignment Length:190 Identity:55/190 - (28%)
Similarity:91/190 - (47%) Gaps:31/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PMSGLRQQLKMLGTALLGKRATKSVKKKPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNL 67
            |..|:..|.|            |.|.|...||.:.:::|.||||.|.:..|.:...||:..::.|
 Frog     8 PSLGVTTQRK------------KPVPKPELTEEQKQEIREAFDLFDTDGAGTIDVKELKVAMRAL 60

  Fly    68 GINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDL 132
            |.....|.|..:|.:....|.|.|:..:|:..:.:..|          .||||         |::
 Frog    61 GFEPKKEEIKKMIADIDKEGTGKISFGDFMSAMTQKMA----------EKDSK---------EEI 106

  Fly   133 IAAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            :.|||:||.|..|.|:...|:...:.:||.|.:::|::::..||.|.||.:|.:||.|::
 Frog   107 MKAFRLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 48/160 (30%)
cetn1NP_001017149.1 PTZ00183 16..172 CDD:185503 52/182 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.