DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and ocm4.2

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001016487.1 Gene:ocm4.2 / 549241 XenbaseID:XB-GENE-5837860 Length:109 Species:Xenopus tropicalis


Alignment Length:65 Identity:20/65 - (30%)
Similarity:33/65 - (50%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 DLIAAFRVFDRDGNGFITRDELQTAMEMI---GEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            |:...|.:.|:|.:|||..|||:..::..   ...|.:.:.:..|...|.|.||:|..:||..|:
 Frog    43 DVRNVFAILDQDRSGFIEEDELKLFLQNFNAGARALTDAETKAFLNAGDSDGDGKIGVDEFQALV 107

  Fly   193  192
             Frog   108  107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 20/65 (31%)
ocm4.2NP_001016487.1 EFh_parvalbumin_beta 9..108 CDD:319998 20/65 (31%)
EF-hand motif 9..38 CDD:319998
EF-hand motif 43..72 CDD:319998 10/28 (36%)
EF-hand motif 82..108 CDD:319998 9/26 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.