DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Calm5

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001008706.1 Gene:Calm5 / 494124 MGIID:3511177 Length:140 Species:Mus musculus


Alignment Length:141 Identity:45/141 - (31%)
Similarity:80/141 - (56%) Gaps:23/141 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRDEQHS 112
            :.|:||.:...||..::|.||.|:|.|.:..||.:....|:|.|:..||.:.:        ::::
Mouse     8 EENKDGHINVQELGDVMKQLGKNLSHEELKALISKLDTDGDGKISFEEFFKSI--------KKYT 64

  Fly   113 HEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQQLEQLLVIADL 177
            .|               ::|.|.|.|.|::|:|:||.|||:..:..:||||::::||.::.:...
Mouse    65 KE---------------QELQAMFSVLDQNGDGYITVDELKEGLSKMGEPLSQEELEGMIHVFGA 114

  Fly   178 DQDGRINYEEF 188
            ||||::|||:|
Mouse   115 DQDGKVNYEQF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 45/141 (32%)
Calm5NP_001008706.1 EFh 10..56 CDD:238008 16/45 (36%)
EFh 35..94 CDD:238008 20/81 (25%)
EF-hand_7 36..91 CDD:290234 20/77 (26%)
EFh 68..128 CDD:238008 26/58 (45%)
EF-hand_7 69..129 CDD:290234 26/57 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.