DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CG17272

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster


Alignment Length:162 Identity:37/162 - (22%)
Similarity:82/162 - (50%) Gaps:28/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FTEVEIKDLRTAFDLLDRNRDGRV-TANELQFMLKNLGINVS-DELIHDLIREASHSGNGLINEA 94
            |.|.:|.:.|..|.|..|:  |:: ..:||..::::||::.: .||:..|.::     ||.::.|
  Fly     5 FKEQDIDEFRECFYLFARS--GQINNLDELTVIMRSLGLSPTIQELVSYLKQK-----NGKMSFA 62

  Fly    95 EFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMI 159
            :||          |..|.|         .:.:.:.:::||||:..|....|.|:..:|:..::..
  Fly    63 DFL----------DIMHQH---------SKVESLPDEVIAAFKAADPQNKGTISARQLRNLLQNW 108

  Fly   160 GEPLNEQQLEQLLVIADLDQDGRINYEEFTRL 191
            ||.|:.::::.:...|:::.:..:.|.:|.::
  Fly   109 GEGLSMREVDNIFREANVNNNSTVRYADFVKI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 36/161 (22%)
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 37/162 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.