DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and pvalb6

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_991136.1 Gene:pvalb6 / 402806 ZFINID:ZDB-GENE-040912-95 Length:109 Species:Danio rerio


Alignment Length:100 Identity:28/100 - (28%)
Similarity:47/100 - (47%) Gaps:19/100 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SHEDSKDSKPVDEADD----------------VTEDLIAAFRVFDRDGNGFITRDELQTAMEMI- 159
            :|:|.|.:....:|.|                .::|:..||.:.|.|.:|||..:||:..::.. 
Zfish     8 NHDDIKKALDACKAPDSFNHKSFFEMVGLKAKASDDVKKAFHLLDADNSGFIEEEELKFVLKAFA 72

  Fly   160 --GEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
              |..|.:::.:..|..||.|.||:|..|||..|:
Zfish    73 TDGRDLTDKETKAFLQAADKDGDGKIGAEEFAALV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 28/99 (28%)
pvalb6NP_991136.1 EFh_parvalbumin_like 10..109 CDD:330177 27/97 (28%)
EF-hand motif 10..38 CDD:319994 4/27 (15%)
EF-hand motif 43..72 CDD:319994 10/28 (36%)
EF-hand motif 82..109 CDD:319994 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.