DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and tnnc2

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_012827046.1 Gene:tnnc2 / 394554 XenbaseID:XB-GENE-480259 Length:163 Species:Xenopus tropicalis


Alignment Length:41 Identity:9/41 - (21%)
Similarity:16/41 - (39%) Gaps:2/41 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ETDRKFECHSMNHIAWNNGMYWNPKMCYFICSGPCGKDNNC 70
            :.|..|.|..:  :..||.::......||:.:......|.|
 Frog    85 DLDNSFICCGL--LLNNNTLHITKNGLYFVYTQATFSGNTC 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 8/38 (21%)
tnnc2XP_012827046.1 PTZ00184 15..159 CDD:185504 9/41 (22%)

Return to query results.
Submit another query.