DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CG13898

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster


Alignment Length:153 Identity:41/153 - (26%)
Similarity:76/153 - (49%) Gaps:19/153 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWV 100
            :::|:..||:|.|..:.||:.|::|..:::.||.|.::..|:..........||.|...:|:..:
  Fly    12 DLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTESEIYRYSEGLEGDVNGYIQLTDFIDLM 76

  Fly   101 GRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLNE 165
            .:|       :|...|.|.            |.||:..||.|.:|.:|..||:.....:||.:::
  Fly    77 TKI-------YSAMGSSDY------------LKAAYNAFDFDKDGLVTYGELRHVFINLGEKISD 122

  Fly   166 QQLEQLLVIADLDQDGRINYEEF 188
            ::..::...||:|.||.||:.:|
  Fly   123 EEFNEVFRQADVDGDGVINFRDF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 41/153 (27%)
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 41/153 (27%)
EFh 18..77 CDD:298682 16/58 (28%)
EFh 88..148 CDD:238008 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.