DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CG9406

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster


Alignment Length:154 Identity:36/154 - (23%)
Similarity:71/154 - (46%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGN--GLINEAEF 96
            |:|.| :..||.:.|.:.|..:.:..:..:|:.||...:::.:.|:|: |:.|.:  |..:..:|
  Fly    10 ELEEK-ISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKEVEDVIK-ATDSVDYPGEAHLVKF 72

  Fly    97 LQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGE 161
            ::.|.::  |.|.|.....|             |.|:.||...|.:...::|::.....|...||
  Fly    73 MEHVSKL--LMDRQMEPASS-------------EKLLEAFETLDPENKKYLTKEYFGKLMAEEGE 122

  Fly   162 PLNEQQLEQLLVIADLDQDGRINY 185
            |.:.::|:.:..:|.....|.|.|
  Fly   123 PFSAEELDAMWPVAIDPITGHIPY 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 36/154 (23%)
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 36/154 (23%)

Return to query results.
Submit another query.