DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CG11041

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_611453.2 Gene:CG11041 / 37278 FlyBaseID:FBgn0034481 Length:155 Species:Drosophila melanogaster


Alignment Length:157 Identity:34/157 - (21%)
Similarity:73/157 - (46%) Gaps:16/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREA-SHSGNGLINEAEFLQWVG 101
            |.:..||.:.|.:.|..:...|:..:|:.||...::|.::::|... |...:|.::..:||..|.
  Fly    11 KRISDAFCVFDHHGDKFIDVREVGTVLRLLGCVPTEEEVNEVISATESEETSGEVHLTKFLPHVS 75

  Fly   102 RIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQ 166
            ::..        |...:..|       .|.::.||::.|.:..|::|::.....|...|||..::
  Fly    76 QLLM--------ERKMEPAP-------PEKILQAFKILDPENKGYLTKESFGKLMMEEGEPFTQE 125

  Fly   167 QLEQLLVIADLDQDGRINYEEFTRLLL 193
            :::::..:|.....|.|.||.:...|:
  Fly   126 EMDEMWPVAIDPISGHIPYEFYLNQLM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 33/155 (21%)
CG11041NP_611453.2 PTZ00184 15..152 CDD:185504 32/151 (21%)

Return to query results.
Submit another query.