DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and azot

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:149 Identity:49/149 - (32%)
Similarity:82/149 - (55%) Gaps:19/149 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRD 108
            |.:||::.:|.:|:.|:..:::.||...:|..:..:|.|....|||.|...||...:  ::.:||
  Fly    16 FRILDKDNEGAITSKEMAVVIRALGRQPNDAEVQSMINEVDSEGNGSIVAPEFCNVI--LRKMRD 78

  Fly   109 EQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQQLEQLLV 173
            .  :|||               :|..|||:||:|.||:||..||:.....:|..|::.:||:::.
  Fly    79 T--NHED---------------ELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIR 126

  Fly   174 IADLDQDGRINYEEFTRLL 192
            ..|||||..:|||||..::
  Fly   127 EYDLDQDNHLNYEEFVNMM 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 49/149 (33%)
azotNP_610336.1 PTZ00184 1..148 CDD:185504 49/149 (33%)
EFh 12..72 CDD:238008 17/55 (31%)
EFh 84..146 CDD:238008 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.