DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and TpnC4

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001163055.1 Gene:TpnC4 / 35498 FlyBaseID:FBgn0033027 Length:153 Species:Drosophila melanogaster


Alignment Length:164 Identity:35/164 - (21%)
Similarity:78/164 - (47%) Gaps:21/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEF 96
            :.:.:::.||.||...|.:..|.:...::..:|:.||..:....:..||:|......|.::.::|
  Fly     6 YDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAVKALIKEVDKGTTGKLDFSQF 70

  Fly    97 LQWVGRIQALRDEQHSHEDSKDSKPVDEADDV---TEDLIAAFRVFDRDGNGFITRDELQTAMEM 158
            .:...|.                  ::..:||   ..:|..||||:|::|.|::|...|:..:..
  Fly    71 CKLAARF------------------IEVEEDVGALQNELKEAFRVYDKEGKGYLTVATLRGILHE 117

  Fly   159 IGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            :.:.|:.|.|:.::...|.|..|.::::||.:::
  Fly   118 LDDKLSNQDLDMIIEEIDADGSGTVDFDEFMQVM 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 35/163 (21%)
TpnC4NP_001163055.1 PTZ00184 1..152 CDD:185504 35/164 (21%)
EFh 14..75 CDD:238008 14/60 (23%)
EFh 90..152 CDD:238008 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.