DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CG17493

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster


Alignment Length:177 Identity:54/177 - (30%)
Similarity:85/177 - (48%) Gaps:24/177 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KRATKSVKKKPFTEVEIK-----DLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLI 80
            ||.|:..:||...:.|:.     |::.||||.|....|.:...||:..::.||.....|.|..:|
  Fly    19 KRGTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKRMI 83

  Fly    81 REASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNG 145
            .:.....:|.|....|||.:....|          .||:|         |:::.|||:||.|..|
  Fly    84 SDIDKDCSGRIAFNVFLQLMTIKMA----------EKDTK---------EEILKAFRLFDDDDTG 129

  Fly   146 FITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            .|:...|:.....:||.|.:::|.:::..||||.||.:|.|||.|::
  Fly   130 KISFRNLKRVARELGETLTDEELREMIDEADLDNDGEVNQEEFLRIM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 49/165 (30%)
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 51/170 (30%)
EFh 42..104 CDD:238008 19/61 (31%)
EFh 115..177 CDD:238008 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.