DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Efcab6

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_038936237.1 Gene:Efcab6 / 315179 RGDID:1309065 Length:1509 Species:Rattus norvegicus


Alignment Length:223 Identity:55/223 - (24%)
Similarity:89/223 - (39%) Gaps:43/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SPMSGLRQQLKMLGTALLGKRATKSVK-KKPFTEVE-------------IKDLRTAFDLLDRNRD 52
            |.:|||.       |..|..|.|..:. .:.|...|             .:|...||..:|.:||
  Rat   718 SMLSGLE-------TVPLQSRPTSKMNLDEHFVSAEECLRIFPKKLKDSFRDSYAAFFRIDTDRD 775

  Fly    53 GRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGL---INEAEFLQ------WVG-----RI 103
            |.::.::|..:|:.|.||:.|   .:..|..|..|..|   :|..||..      |..     |:
  Rat   776 GIISMHDLHRLLQYLLINMMD---FEFERFLSLMGLRLSVTLNFREFQNLCEKRPWKSDEAPQRL 837

  Fly   104 ----QALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLN 164
                |.:.|.:.:.|.:.... :.:|.....||...|...|.:|||.:.|.:::.::.....||.
  Rat   838 IRCKQKVADSELACEQAHQYL-IMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLT 901

  Fly   165 EQQLEQLLVIADLDQDGRINYEEFTRLL 192
            .::.|:|....|.:..|.|.|:||...|
  Rat   902 PREFEKLWQNYDTEGRGYITYQEFLHRL 929

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 46/191 (24%)
Efcab6XP_038936237.1 FRQ1 82..264 CDD:227455
EFh_parvalbumin_like <420..490 CDD:330177
EF-hand motif 429..457 CDD:319994
EF-hand motif 465..490 CDD:319994
EFh_PI-PLC 869..980 CDD:333715 18/61 (30%)
EF-hand motif 869..897 CDD:320029 7/27 (26%)
EF-hand_7 873..927 CDD:404394 16/53 (30%)
EF-hand motif 904..929 CDD:320029 8/24 (33%)
FRQ1 1086..1247 CDD:227455
EF-hand_11 1170..1274 CDD:401068
PTZ00183 1335..1505 CDD:185503
EF-hand_7 1447..1507 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.