DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CG11638

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_569879.1 Gene:CG11638 / 31050 FlyBaseID:FBgn0040351 Length:387 Species:Drosophila melanogaster


Alignment Length:165 Identity:48/165 - (29%)
Similarity:92/165 - (55%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KKKPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLIN 92
            |::..::.::::.|.||.|.|::.||.:|..||..::::||.....|.:.::::|....|:|.::
  Fly   202 KRRCISKGQMREFREAFRLFDKDGDGCITKEELGTVMRSLGQFARVEELQEMLQEIDVDGDGNVS 266

  Fly    93 EAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAME 157
            ..||:..:           |:...:|...:..||....:|..||||||:...|:||..:|:..::
  Fly   267 FEEFVDIL-----------SNMTYEDKSGLSSADQEERELRDAFRVFDKHNRGYITASDLRAVLQ 320

  Fly   158 MIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            .:||.|:|:.:|.::...|:|.||||::.||...|
  Fly   321 CLGEDLDEEDIEDMIKEVDVDGDGRIDFYEFVHAL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 47/160 (29%)
CG11638NP_569879.1 EFh 213..275 CDD:238008 18/72 (25%)
EF-hand_7 215..274 CDD:290234 18/58 (31%)
EFh 294..355 CDD:238008 24/60 (40%)
EF-hand_7 295..355 CDD:290234 24/59 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.