DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Tnnc2

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001032428.1 Gene:Tnnc2 / 296369 RGDID:1311973 Length:160 Species:Rattus norvegicus


Alignment Length:160 Identity:46/160 - (28%)
Similarity:82/160 - (51%) Gaps:16/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFL 97
            :|..|.:.:.|||:.|.:..|.::..||..:::.||...:.|.:..:|.|....|:|.|:..|||
  Rat    13 SEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFL 77

  Fly    98 QWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEP 162
            ..:.|        ...||:|...        .|:|...||:|||:.:|:|..:||.......||.
  Rat    78 VMMVR--------QMKEDAKGKS--------EEELAECFRIFDRNADGYIDAEELAEIFRASGEH 126

  Fly   163 LNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            :.::::|.|:...|.:.||||:::||.:::
  Rat   127 VTDEEIESLMKDGDKNNDGRIDFDEFLKMM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 46/160 (29%)
Tnnc2NP_001032428.1 PTZ00184 12..156 CDD:185504 46/158 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.