DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Efcab2

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_038946462.1 Gene:Efcab2 / 289280 RGDID:1308593 Length:179 Species:Rattus norvegicus


Alignment Length:172 Identity:42/172 - (24%)
Similarity:84/172 - (48%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREA-SHSGNGLINEAEFLQWVG 101
            |.::.||::.|...:..|...|:..::::||.:.::..:||.|.|. .....|.|...:|:..:.
  Rat    19 KKIKEAFEVFDHESNNTVDVREIGTIIRSLGCSPTEGELHDFIAEVEEEEPTGYIRFEKFIPVMT 83

  Fly   102 RIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAM---------- 156
            .:  |.::::        :|:  |:||   |:.||.|.|....||:|:|||...|          
  Rat    84 TV--LLEKRY--------RPI--AEDV---LLRAFEVLDPTKRGFLTKDELVKYMTEEGVLFPWR 133

  Fly   157 -----EMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLLL 193
                 |:.|||.:::::|::|..|...:...|||.::..:::
  Rat   134 LPLELELHGEPFSQEEMEEMLSAAIDPESNTINYRDYITMMV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 42/170 (25%)
Efcab2XP_038946462.1 PTZ00184 22..175 CDD:185504 41/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.