DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Cetn2

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_062278.2 Gene:Cetn2 / 26370 MGIID:1347085 Length:172 Species:Mus musculus


Alignment Length:178 Identity:51/178 - (28%)
Similarity:91/178 - (51%) Gaps:20/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TALLGKRATKSVKKKP-FTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDL 79
            |.:......|.:..|| .||.:.:::|.||||.|.:..|.:...||:..::.||.....|.|..:
Mouse     8 TTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRALGFEPKKEEIKKM 72

  Fly    80 IREASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGN 144
            |.|....|.|.:|.::||       .:..::.|.:|:|            |:::.||::||.|..
Mouse    73 ISEIDKEGTGKMNFSDFL-------TVMTQKMSEKDTK------------EEILKAFKLFDDDET 118

  Fly   145 GFITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            |.|:...|:...:.:||.|.:::|::::..||.|.||.:|.:||.|::
Mouse   119 GKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 47/160 (29%)
Cetn2NP_062278.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 6/22 (27%)
Required for self-assembly. /evidence=ECO:0000250 2..25 4/16 (25%)
PTZ00183 16..172 CDD:185503 50/170 (29%)
EFh 32..94 CDD:238008 20/68 (29%)
EFh 105..167 CDD:238008 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.