DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and cam2

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_594877.1 Gene:cam2 / 2542611 PomBaseID:SPAC29A4.05 Length:143 Species:Schizosaccharomyces pombe


Alignment Length:163 Identity:42/163 - (25%)
Similarity:84/163 - (51%) Gaps:23/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAE 95
            |.::.:..:::.||.|.|.::||.:..:.:..:|::|||||:|..:..|..|...:    |:|.:
pombe     2 PASKEQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAELAKLSNELGDA----IDEKK 62

  Fly    96 FLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIG 160
            |:.:|.  ..||:.:..                 |:.|.||||||:|.:|:|...:....|:.:|
pombe    63 FMSFVS--NKLRETESE-----------------EEYIKAFRVFDKDNSGYIETAKFADYMKTLG 108

  Fly   161 EPLNEQQLEQLLVIADLDQDGRINYEEFTRLLL 193
            |.|::.:::.::..||....|..:|.:|.:.::
pombe   109 EKLSDNEVQLMVQEADPTNSGSFDYYDFVQRIM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 41/159 (26%)
cam2NP_594877.1 FRQ1 1..143 CDD:227455 42/163 (26%)
EFh 10..105 CDD:298682 32/117 (27%)
EFh 79..141 CDD:238008 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.