DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and T09B4.4

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_491778.2 Gene:T09B4.4 / 188316 WormBaseID:WBGene00020378 Length:142 Species:Caenorhabditis elegans


Alignment Length:115 Identity:26/115 - (22%)
Similarity:51/115 - (44%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGLRQQLKMLGTALLGKRAT---KSVKKKP-----FTEV---------EIKDLRTAFDLLDRNRD 52
            |.||..|:.||.:....:..   |.:.|||     |.::         .:.::..|...||||:.
 Worm    30 SQLRCALRSLGYSPTASKTDIYFKKLNKKPIEFATFLDICKDEQNSPNPLTEIIKALSGLDRNKT 94

  Fly    53 GRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGR 102
            ..:.:.||..:|.::|..:|.|.|..|:.:.  ..||::.....::::.:
 Worm    95 RAMPSRELAAILSHVGEQMSPEEIKYLLSKV--EVNGMVPHQALIEYISK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 15/79 (19%)
T09B4.4NP_491778.2 PTZ00183 5..129 CDD:185503 24/100 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.