DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and cal-2

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_495906.2 Gene:cal-2 / 182789 WormBaseID:WBGene00000286 Length:171 Species:Caenorhabditis elegans


Alignment Length:155 Identity:52/155 - (33%)
Similarity:88/155 - (56%) Gaps:20/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQ 98
            |.||.:.:.||.|.|::.:|.:::.||...:::||.|.:::.:.|::.|....|:|.|:..||.|
 Worm    31 EEEIMEYKAAFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELLDMVNEVDIDGSGTIDFGEFCQ 95

  Fly    99 WVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPL 163
            .:.|:....|.:...|                    ||||||||||||||.||.:..|..:|:..
 Worm    96 MMKRMNKENDSEMIRE--------------------AFRVFDRDGNGFITADEFRYFMTHMGDQF 140

  Fly   164 NEQQLEQLLVIADLDQDGRINYEEF 188
            ::|::::::...|:|.||:|:||||
 Worm   141 SDQEVDEIIAEIDIDGDGQIDYEEF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 52/155 (34%)
cal-2NP_495906.2 PTZ00184 27..165 CDD:185504 50/153 (33%)
EFh 36..98 CDD:238008 18/61 (30%)
EFh 108..166 CDD:238008 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.