DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and B0563.7

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_509544.1 Gene:B0563.7 / 182041 WormBaseID:WBGene00015264 Length:229 Species:Caenorhabditis elegans


Alignment Length:191 Identity:42/191 - (21%)
Similarity:89/191 - (46%) Gaps:21/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PMSGLRQQLKMLGTALLGKRATKSVKKKPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNL 67
            |.:|.:......||....:...:.::.| :|..|:|:.|..|::.|.:..|.:...||:..:.::
 Worm    17 PQTGRKISTSSRGTIHSQQSQPEDIQMK-YTRKELKEYRQLFNMFDTDGSGAIGNEELKQAMISI 80

  Fly    68 GINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDL 132
            |::.:...|.::|:|....|||.|:..||...:.:.|.:                  .....|:|
 Worm    81 GLHANKAEIDNVIKEVDADGNGEIDFEEFCACMKKSQNI------------------VKSTNEEL 127

  Fly   133 I-AAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            | ..|.:||:|.||.||.:|.:...:..|: .:::..|::....|:..:|.::.::|..::
 Worm   128 IRECFEIFDQDRNGIITENEFKYIAKEFGD-FDDELAEKVFRELDVSANGHLSADQFATIV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 37/161 (23%)
B0563.7NP_509544.1 PTZ00184 46..183 CDD:185504 36/155 (23%)
EFh 52..114 CDD:238008 16/61 (26%)
EFh 88..153 CDD:238008 22/82 (27%)
EFh 128..187 CDD:238008 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.