DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and E02A10.3

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001343832.1 Gene:E02A10.3 / 179722 WormBaseID:WBGene00008453 Length:283 Species:Caenorhabditis elegans


Alignment Length:161 Identity:43/161 - (26%)
Similarity:85/161 - (52%) Gaps:18/161 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEF 96
            ::|.|:::.|..|::.|.:|.|.:..:||:..:||||:..:.:.:..:|.|....||..|:..||
 Worm   131 YSEEELQEYRQVFNMFDADRSGAIAIDELEAAIKNLGLEQTRDELDKIIDEVDQRGNHQIDFDEF 195

  Fly    97 LQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGE 161
            ...:.|:        :.:.|..::.|.|          .|.||||..||.|::.:.:..:..:|:
 Worm   196 CVVMRRL--------TMKKSNWNEVVKE----------CFTVFDRSENGGISKKDFRFILRELGD 242

  Fly   162 PLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            ..:.|.::::...||:|.:|.|:|:|||.::
 Worm   243 ITDNQIIDEIFNEADVDGNGVIDYDEFTYMV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 43/160 (27%)
E02A10.3NP_001343832.1 EFh_PEF 132..273 CDD:330173 43/158 (27%)
EF-hand motif 140..167 CDD:320054 9/26 (35%)
EF-hand motif 175..203 CDD:320054 8/35 (23%)
EF-hand motif 208..241 CDD:320054 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.