DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and cal-4

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001379504.1 Gene:cal-4 / 177945 WormBaseID:WBGene00000288 Length:236 Species:Caenorhabditis elegans


Alignment Length:162 Identity:47/162 - (29%)
Similarity:87/162 - (53%) Gaps:22/162 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEF 96
            ||..|:::...||.|.|::.:..:...||...::.||:|.::|.:.:::.|....|||.|:..||
 Worm    71 FTPEELQEFAQAFKLFDKDGNNTMNIKELGEAMRMLGLNPTEEELLNMVNEYDVDGNGKIDFGEF 135

  Fly    97 LQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLI-AAFRVFDRDGNGFITRDELQTAMEMIG 160
                               .|..|.:::..|  ::|| .||:|||:||||:||..|.:..|..:|
 Worm   136 -------------------CKMMKEMNKETD--QELIRLAFKVFDKDGNGYITAQEFKHFMTTMG 179

  Fly   161 EPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            |..:|:::::::...|.|.|.:|:.:||..::
 Worm   180 ERFSEEEVDEIIREVDKDGDEQIDLDEFVNMV 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 46/161 (29%)
cal-4NP_001379504.1 PTZ00184 68..211 CDD:185504 47/160 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.