DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CALML6

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_005244786.2 Gene:CALML6 / 163688 HGNCID:24193 Length:203 Species:Homo sapiens


Alignment Length:211 Identity:57/211 - (27%)
Similarity:99/211 - (46%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLRQQLKMLGTALLGKRATKSV------KKKPF--------------TE----VEIKDLRTAFDL 46
            ||:|::.::....:|..:.:.:      .|:|:              ||    .:||:.:..|::
Human     2 GLQQEISLVSDDSMGPGSHEDLLEGRTSGKQPWCHHPAESCQTTTDMTERLSAEQIKEYKGVFEM 66

  Fly    47 LDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRDEQH 111
            .|...:|.|...||::::..||||.:...:..:.::......|..|...||       ||....|
Human    67 FDEEGNGEVKTGELEWLMSLLGINPTKSELASMAKDVDRDNKGFFNCDGFL-------ALMGVYH 124

  Fly   112 SHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQQLEQLLVIAD 176
            ....:::|           :|.|||||||::|.|:|..:.|:..:...||||||.:.||::..||
Human   125 EKAQNQES-----------ELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQMMKEAD 178

  Fly   177 LDQDGRINYEEFTRLL 192
            .|.|..|:||||..::
Human   179 KDGDRTIDYEEFVAMM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 51/164 (31%)
CALML6XP_005244786.2 PTZ00184 48..195 CDD:185504 51/165 (31%)
EFh 59..120 CDD:238008 15/67 (22%)
EFh 133..195 CDD:238008 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D604129at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.