DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Caln1

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_006504429.3 Gene:Caln1 / 140904 MGIID:2155987 Length:274 Species:Mus musculus


Alignment Length:113 Identity:37/113 - (32%)
Similarity:58/113 - (51%) Gaps:21/113 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 HSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSK-----PVDEADDVTEDLIAAFRVFDRDGN 144
            |...||:.:..:|            ..|.....||:     .|:|.|::.|    ||||.|||||
Mouse    60 HVTAGLLYKGNYL------------NRSLSAGSDSEQLANISVEELDEIRE----AFRVLDRDGN 108

  Fly   145 GFITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            |||::.||..||..:|...:|.:|..::...|:|.||:::::||..:|
Mouse   109 GFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTIL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 37/113 (33%)
Caln1XP_006504429.3 PTZ00184 87..>197 CDD:185504 30/74 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.