DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Calm3

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_031616.1 Gene:Calm3 / 12315 MGIID:103249 Length:149 Species:Mus musculus


Alignment Length:160 Identity:57/160 - (35%)
Similarity:95/160 - (59%) Gaps:19/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFL 97
            ||.:|.:.:.||.|.|::.||.:|..||..::::||.|.::..:.|:|.|....|||.|:..|||
Mouse     6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70

  Fly    98 QWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIGEP 162
            ..:.|            ..||:       |..|::..||||||:||||:|:..||:..|..:||.
Mouse    71 TMMAR------------KMKDT-------DSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEK 116

  Fly   163 LNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            |.::::::::..||:|.||::|||||.:::
Mouse   117 LTDEEVDEMIREADIDGDGQVNYEEFVQMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 57/160 (36%)
Calm3NP_031616.1 PTZ00184 1..149 CDD:185504 57/160 (36%)
Necessary and sufficient for interaction with PCP4. /evidence=ECO:0000250|UniProtKB:P0DP25 77..149 31/77 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.