DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and ocm

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_002931997.1 Gene:ocm / 100485867 XenbaseID:XB-GENE-488140 Length:113 Species:Xenopus tropicalis


Alignment Length:57 Identity:18/57 - (31%)
Similarity:29/57 - (50%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 FRVFDRDGNGFITRDELQTAMEMIGEP----LNEQQLEQLLVIADLDQDGRINYEEF 188
            |.|.|.|.:|::..|||:..::.. :|    |...:.:..:...|.|.||:|..|||
 Frog    48 FGVMDNDESGYVEEDELKYILQRF-DPSARVLTSSEAKDFMAGVDHDGDGKIGVEEF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 18/57 (32%)
ocmXP_002931997.1 EFh_parvalbumin_beta 9..108 CDD:319998 18/57 (32%)
EF-hand motif 9..38 CDD:319998
EF-hand motif 43..72 CDD:319998 8/24 (33%)
EF-hand motif 82..108 CDD:319998 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.