DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tws and PPP2R2B

DIOPT Version :9

Sequence 1:NP_001287269.1 Gene:tws / 47877 FlyBaseID:FBgn0004889 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_858060.2 Gene:PPP2R2B / 5521 HGNCID:9305 Length:509 Species:Homo sapiens


Alignment Length:519 Identity:354/519 - (68%)
Similarity:406/519 - (78%) Gaps:43/519 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLEPPDPQMQTTPPPP--TLPPRTFMRQSSITKIGNMLNTAININGAKKPAS----NGEASWCF- 67
            :|..|...:||:...|  .||.|......|.|             |:..|.|    .||.||.. 
Human     2 LLSLPALHLQTSEHHPFFQLPHRRLGPWCSPT-------------GSPAPLSCETGCGEGSWILV 53

  Fly    68 ------SQIK-GALDDDV----------------TDADIISCVEFNHDGELLATGDKGGRVVIFQ 109
                  :|:. .::::|:                |:|||||.|||||.|||||||||||||||||
Human    54 CRLLVPTQVSLLSMEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQ 118

  Fly   110 RDPASKAANPRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLQQKNPVHFLLSTNDKTVKL 174
            |:..||....||||||||||||||||||||||||||||||||||||.|:|..:||||||||||||
Human   119 REQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKL 183

  Fly   175 WKVSERDKSFGGYNTKEENGLIRDPQNVTALRVPSVKQIPLLVEASPRRTFANAHTYHINSISVN 239
            ||||||||...|||.|:|.|.:|||..:|.||||.::.:.|:|||:|||.|||||||||||||||
Human   184 WKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVN 248

  Fly   240 SDQETFLSADDLRINLWHLEVVNQSYNIVDIKPTNMEELTEVITAAEFHPTECNVFVYSSSKGTI 304
            ||.||::||||||||||:.|:.|||:|||||||.||||||||||||||||..||.||||||||||
Human   249 SDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTI 313

  Fly   305 RLCDMRSAALCDRHSKQFEEPENPTNRSFFSEIISSISDVKLSNSGRYMISRDYLSIKVWDLHME 369
            ||||||::||||||:|.|||||:|:||||||||||||||||.|:||||:::||||::|||||:||
Human   314 RLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRDYLTVKVWDLNME 378

  Fly   370 TKPIETYPVHEYLRAKLCSLYENDCIFDKFECCWNGKDSSIMTGSYNNFFRVFDRNSKKDVTLEA 434
            .:|||||.||:|||:|||||||||||||||||.|||.||.|||||||||||:||||:|:||||||
Human   379 NRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEA 443

  Fly   435 SRDIIKPKTVLKPRKVCTGGKRKKDEISVDCLDFNKKILHTAWHPEENIIAVAATNNLFIFQDK 498
            ||:..||:.:|||||||.||||:|||||||.|||:||||||||||.||||||||||||:|||||
Human   444 SRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twsNP_001287269.1 CDC55 65..495 CDD:227498 333/453 (74%)
WD40 82..423 CDD:295369 270/340 (79%)
WD40 repeat 84..132 CDD:293791 38/47 (81%)
WD40 repeat 150..227 CDD:293791 50/76 (66%)
WD40 repeat 233..272 CDD:293791 30/38 (79%)
WD40 repeat 283..323 CDD:293791 32/39 (82%)
WD40 repeat 341..377 CDD:293791 25/35 (71%)
WD40 repeat 398..439 CDD:293791 33/40 (83%)
PPP2R2BNP_858060.2 CDC55 88..504 CDD:227498 330/415 (80%)
WD40 repeat 93..141 CDD:293791 38/47 (81%)
WD40 repeat 159..236 CDD:293791 50/76 (66%)
WD40 repeat 242..278 CDD:293791 27/35 (77%)
WD40 repeat 292..343 CDD:293791 41/50 (82%)
WD40 repeat 350..386 CDD:293791 25/35 (71%)
WD40 repeat 407..442 CDD:293791 28/34 (82%)
WD40 repeat 481..504 CDD:293791 20/22 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159610
Domainoid 1 1.000 740 1.000 Domainoid score I99
eggNOG 1 0.900 - - E1_COG5170
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 740 1.000 Inparanoid score I594
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54269
OrthoDB 1 1.010 - - D266049at33208
OrthoFinder 1 1.000 - - FOG0000622
OrthoInspector 1 1.000 - - otm40258
orthoMCL 1 0.900 - - OOG6_100728
Panther 1 1.100 - - O PTHR11871
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2
SonicParanoid 1 1.000 - - X368
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.