DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bgcn and Zcchc17

DIOPT Version :9

Sequence 1:NP_523832.2 Gene:bgcn / 47873 FlyBaseID:FBgn0004581 Length:1215 Species:Drosophila melanogaster
Sequence 2:NP_694800.1 Gene:Zcchc17 / 619605 MGIID:1919955 Length:241 Species:Mus musculus


Alignment Length:147 Identity:31/147 - (21%)
Similarity:49/147 - (33%) Gaps:62/147 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 KVVLATDIIESLCLKVPFKYQIDTACRLNNVYDTT---SCSGDDRFEWVAKDALLRRELILQPNK 622
            :|.:.||.  ...:|:|       .||...:...|   ||..|...|.|              :.
Mouse    22 EVAMVTDY--GAFIKIP-------GCRKQGLVHRTHMSSCRVDKPSEIV--------------DV 63

  Fly   623 GDVQCFRLISKEAYEELSETSQPSLQTMQLD--KICLAVKL--------LSPNTIISE------- 670
            ||....:||.:|               |:.|  |:.|::|:        |.||.::.|       
Mouse    64 GDKVWVKLIGRE---------------MKNDRIKVSLSMKVVNQGTGKDLDPNNVVIEQEERRRR 113

  Fly   671 ----YLGITISPPPLIN 683
                |.|..|:...::|
Mouse   114 SFQDYTGQKITLEAVLN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bgcnNP_523832.2 ANK repeat 406..438 CDD:293786
ANK 407..>460 CDD:238125
Ank_2 413..>460 CDD:289560
HrpA <484..973 CDD:224557 31/147 (21%)
HA2 694..763 CDD:214852
OB_NTP_bind 823..945 CDD:285018
Zcchc17NP_694800.1 S1_pNO40 13..86 CDD:240191 21/101 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.