DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bgcn and DQX1

DIOPT Version :9

Sequence 1:NP_523832.2 Gene:bgcn / 47873 FlyBaseID:FBgn0004581 Length:1215 Species:Drosophila melanogaster
Sequence 2:NP_598376.2 Gene:DQX1 / 165545 HGNCID:20410 Length:717 Species:Homo sapiens


Alignment Length:282 Identity:62/282 - (21%)
Similarity:102/282 - (36%) Gaps:81/282 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 PGNILIILPTYYHIVKLNYMILSHCLTGSLQECSIFLLYDNMRNDYLQAL--------------V 553
            ||::|:.||:...|        |.|.....:|....|         ||.|              |
Human   261 PGDVLVFLPSEEEI--------SLCCESLSREVESLL---------LQGLPPRVLPLHPDCGRAV 308

  Fly   554 NA--SDETVKVVLATDIIESLCLKVP-FKYQIDTACRLNNVYDTTSCSGDDRFEWVAKDALLRRE 615
            .|  .|...:.|:.|..:......:| .::.||:...|.:||:..                :|.|
Human   309 QAVYEDMDARKVVVTHWLADFSFSLPSIQHVIDSGLELRSVYNPR----------------IRAE 357

  Fly   616 L-ILQP-NKGDVQ-------------CFRLISKEAYE-ELSETSQPSLQTMQLDKICLAVK---L 661
            . :|:| :|...:             |..|..|...| |.....||.:....|..:.|.:|   :
Human   358 FQVLRPISKCQAEARRLRARGFPPGSCLCLYPKSFLELEAPPLPQPRVCEENLSSLVLLLKRRQI 422

  Fly   662 LSPNTIISEYLGITISPPPLINVHHAVQFLKKID---VLDDAEDVTWLGCRLMDIPVSCQLGRML 723
            ..|..  ..:|.   .|.|    ...:|.|:.:|   .|||..|::.||..|.:.|::.:|.:.|
Human   423 AEPGE--CHFLD---QPAP----EALMQALEDLDYLAALDDDGDLSDLGVILSEFPLAPELAKAL 478

  Fly   724 IFGILLRCLDPILTIVSSLSTA 745
            :......|:|.:||:.:.|:.|
Human   479 LASCEFDCVDEMLTLAAMLTAA 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bgcnNP_523832.2 ANK repeat 406..438 CDD:293786
ANK 407..>460 CDD:238125
Ank_2 413..>460 CDD:289560
HrpA <484..973 CDD:224557 62/282 (22%)
HA2 694..763 CDD:214852 17/55 (31%)
OB_NTP_bind 823..945 CDD:285018
DQX1NP_598376.2 Motor_domain 8..>89 CDD:277568
DEXDc 41..231 CDD:214692
DEXDc 65..204 CDD:238005
DEAQ box 170..173
HA2 <465..530 CDD:214852 10/36 (28%)
OB_NTP_bind 565..674 CDD:285018
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 694..717
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.