DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst98Ca and Mst98Cb

DIOPT Version :9

Sequence 1:NP_524899.1 Gene:Mst98Ca / 47854 FlyBaseID:FBgn0002865 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_524539.1 Gene:Mst98Cb / 43367 FlyBaseID:FBgn0004171 Length:265 Species:Drosophila melanogaster


Alignment Length:290 Identity:259/290 - (89%)
Similarity:259/290 - (89%) Gaps:25/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCSPCGPCSPCDPCCGPFECSPKCYNAAQLEALPQCAPRIPPPFPKCITVQQPPRMICKKRVVFT 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MCSPCGPCSPCDPCCGPFECSPKCYNAAQLEALPQCAPRIPPPFPKCITVQQPPRMICKKRVVFT 65

  Fly    66 EKIVPEPMVVNRCRQITIPKVVDATRVIKVPKLIWVSQMVREPRVIYYPSMIPDPYVVCYPKRVC 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 EKIVPEPMVVNRCRQITIPKVVDATRVIKVPKLIWVSQMVREPRVIYYPSMIPDPYVVCYPKRVC 130

  Fly   131 EPREVCQSILCQPKPQTIDIPPPREYCCYPNGPINYKPSAACPPCPIGPCAPGGPCCPLPCFSTN 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 EPREVCQSILCQPKPQTIDIPPPREYCCYPNGPINYKPSAACPPCPIGPCAPGGPCCPLPCFSTN 195

  Fly   196 QYPVAEGRCGPCGPCGPGCGPCGPRCGPCGPGPCGPCGPRCGPGGPCAVPNCGPCGLTMPSGPFV 260
            |||||||||||||||||||||||| |||.||| ||||||            ||||      |||.
  Fly   196 QYPVAEGRCGPCGPCGPGCGPCGP-CGPWGPG-CGPCGP------------CGPC------GPFG 240

  Fly   261 PAPCGPCAPCGPCGPLGNSPCGPCGPCGPC 290
            |. ||||.|||||||   .||| .||||||
  Fly   241 PG-CGPCGPCGPCGP---GPCG-FGPCGPC 265



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448282
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E5YQ
Homologene 1 1.000 - - H119649
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019552
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.