DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mst98Ca and col-178

DIOPT Version :9

Sequence 1:NP_524899.1 Gene:Mst98Ca / 47854 FlyBaseID:FBgn0002865 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_509869.1 Gene:col-178 / 181307 WormBaseID:WBGene00000751 Length:283 Species:Caenorhabditis elegans


Alignment Length:276 Identity:73/276 - (26%)
Similarity:86/276 - (31%) Gaps:75/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ITIPKVVDATRVIKVPKLIWVSQMVREPRVIYYPSMIPDPYVVCYPKRVCEPREVCQSILCQPKP 145
            :.:..|.....:|.||.|....|.|.        |.:.|..:.|..|.|....|:.:..:.:   
 Worm    21 VAVSTVATLIAIIAVPLLCLHMQTVH--------SGLSDELLFCKSKNVDMRSEIEKLSVIR--- 74

  Fly   146 QTIDIPPPREYCCYPNGPINYKPSAACPPCPIGPCAPGGPCCPLPCFSTNQYPVAEGRCGPCGPC 210
                          .||....:....|..|.||...|.|            .|..||..|..|..
 Worm    75 --------------DNGRQKRQTPQTCCSCGIGETGPAG------------VPGQEGAPGNDGKA 113

  Fly   211 G----PGCG-----------------PCGPRCGPCGPGPCGPCGPRCGP---GGPCAVPNCGPCG 251
            |    ||..                 |.||.....||||.||.||..||   |||....|.||.|
 Worm   114 GQPGAPGADADEQGFHYKAPEFCFDCPAGPPGAVGGPGPKGPPGPPGGPGELGGPGRGGNRGPPG 178

  Fly   252 LTMPSGPFVPAPCGPCAPCGPCGPLGNSPCGPCGPCGPCSPPCPYESPECGPCYPCAPTPWNTHC 316
               |.||  |...||....|..|..|.:...|..|..|..|..|....|.||         :...
 Worm   179 ---PRGP--PGEAGPDGEGGRPGQAGQTRSAPSPPGQPGQPGEPGSPGEPGP---------DGRA 229

  Fly   317 GPVGPCGPQVPCGPSG 332
            |..|..||..|.|.:|
 Worm   230 GHPGRNGPPGPPGDNG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mst98CaNP_524899.1 None
col-178NP_509869.1 Col_cuticle_N 15..67 CDD:198156 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.