DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NFIL3 and Pdp1

DIOPT Version :10

Sequence 1:NP_005375.2 Gene:NFIL3 / 4783 HGNCID:7787 Length:462 Species:Homo sapiens
Sequence 2:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster


Alignment Length:328 Identity:63/328 - (19%)
Similarity:110/328 - (33%) Gaps:130/328 - (39%)


- Green bases have known domain annotations that are detailed below.


Human    61 YVYKPVMDQTCCPQYTIRCHPLQFQPSKSHKKVLKKM----------------LKF--------- 100
            |:..||:|    |..|:|.   .:..|.|.|..|:.|                |.|         
  Fly   261 YMGGPVLD----PDSTLRA---WWSLSYSLKATLRSMVLPLGSLTIGLARHRALLFKVLCDSVGV 318

Human   101 ---LAKGEISKGNCEDEPMDSTVEDAVDGDFALINKLDIKCDLKTL------------------- 143
               :.||:...|: :|..|:|...|  ||...::   |:..|..||                   
  Fly   319 PCRIVKGQQYTGS-DDVAMNSIKTD--DGREYIV---DLMGDPGTLIPADAAGLQMDFDDSVYSA 377

Human   144 --------------SDLKGSIE-------SEEKEKEKSIKKE----GSKEFIHPQSIEEKLG--- 180
                          |.::.|||       :|.:.:.|..::|    |..:.:.| :|.|.:|   
  Fly   378 SPRDVDSSHVASSSSGVESSIEEHTESWSAEHRSRTKGSREENQSAGGGDLMIP-NIREAVGSQK 441

Human   181 ------SGEPSHPIKVHIGPKPGKGADLSKPPCRKAR---------EMRKERQRLKR-------- 222
                  |.:|:|.......|...:|  :|.|..|:.:         :..||..:|.:        
  Fly   442 APVQHLSSKPTHSFTHARSPSWTEG--VSSPAGRRMKVKDVSQYMIDAAKENPQLAQKLHDVLLE 504

Human   223 ---------MQQASAAASEAQGQPVCLLPKAKSNQPKSLEDLIFQSLPENASHKLEVRVVRSSPP 278
                     ..:..:.:.||.|:   :...|:||..|..:   |.:: :...::..:..||..||
  Fly   505 SGVVAPRNLFSEVYSESMEATGE---IKSVAESNDEKGKD---FGTI-QQGRNQSNLGPVRFLPP 562

Human   279 SPQ 281
            .|:
  Fly   563 LPR 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NFIL3NP_005375.2 bZIP_NFIL3 72..131 CDD:269842 19/86 (22%)
coiled coil 73..131 CDD:269842 19/85 (22%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..95 3/15 (20%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 99..106 3/18 (17%)
Vert_IL3-reg_TF 130..461 CDD:368956 40/231 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..237 11/73 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..302 5/24 (21%)
Necessary for transcriptional repression and sufficient for interaction with DR1. /evidence=ECO:0000269|PubMed:8836190 299..363
Pdp1NP_729301.1 NAM-associated 514..609 CDD:464129 13/59 (22%)
bZIP_HLF 580..639 CDD:269843
coiled coil 581..639 CDD:269843
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.