DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-C and XPNPEP1

DIOPT Version :9

Sequence 1:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001311062.1 Gene:XPNPEP1 / 7511 HGNCID:12822 Length:695 Species:Homo sapiens


Alignment Length:600 Identity:132/600 - (22%)
Similarity:200/600 - (33%) Gaps:228/600 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AGKAILKE-----------LLPGLKFNDGN------------------LLVLLEG---GKDQSLY 56
            ||.||:.|           .|...|..|.|                  :.||.||   |.|..:.
Human   103 AGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLII 167

  Fly    57 NTD----VDYVFRQESYFQYLFGVKE-------------PGCYGILTIDVK-TG----------- 92
            .||    :..|.|...:  :|..|||             | |..:||:.:. ||           
Human   168 PTDYWKKMAKVLRSAGH--HLIPVKENLVDKIWTDRPERP-CKPLLTLGLDYTGISWKDKVADLR 229

  Fly    93 ---AQKSVL-FVPRFPDEYGTWMGELLGLQEFKAMYEVDEVFY------VDEMSVYLEG------ 141
               |:::|: ||....||. .|:..|.|     :..|.:.||:      ::.:.::::|      
Human   230 LKMAERNVMWFVVTALDEI-AWLFNLRG-----SDVEHNPVFFSYAIIGLETIMLFIDGDRIDAP 288

  Fly   142 -ASPKLILTLSGTNSDSGLTLQP------------PDFAGKEK-YVTD---------------CN 177
             ....|:|.| |..::..:.:.|            .|.:.:|| :|:|               |.
Human   289 SVKEHLLLDL-GLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC 352

  Fly   178 LLYPILSECRVIKSPEEIEVLRYVAKVSSDAHIKVMRFMRPGRMEFEGESL-----FLHHAYSVG 237
            :.|..:...:.:|:..|.|.:|       .||||            :..:|     :|......|
Human   353 MPYTPICIAKAVKNSAESEGMR-------RAHIK------------DAVALCELFNWLEKEVPKG 398

  Fly   238 GCRH-------------------ASYTCICGSGTNSSILHYGHAGAPNSKPVQDGDLCLFDMGAN 283
            |...                   .|:..|..:|.|.:|:||......| :.:...::.|.|.||.
Human   399 GVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETN-RTLSLDEVYLIDSGAQ 462

  Fly   284 YCGYAADITCTFPANGKFTDDQKFIYNAVLDARNAVTESARDGVSWVDMHKLAGRVLLQRLKEGG 348
            |.....|:|.|... |..|..:|..:..||....||:.:                 :.....:|.
Human   463 YKDGTTDVTRTMHF-GTPTAYEKECFTYVLKGHIAVSAA-----------------VFPTGTKGH 509

  Fly   349 MLKGDVEEMLEAGVSGVFQPHGLGHLIG--LDVHDVGGYLPKEPKRPS-EPWLSKLRFARILKAG 410
            :|.......|  ..||:...||.||.:|  |:||:  |......|..| ||          |:||
Human   510 LLDSFARSAL--WDSGLDYLHGTGHGVGSFLNVHE--GPCGISYKTFSDEP----------LEAG 560

  Fly   411 MYVTIEPGCYFINWLMDRALADPNIAKFINAEMFNRFRNFGGVRIEDDVLI----TKTGVEN--- 468
            |.||.|||.|     .|.|.                     |:|||:.||:    ||....|   
Human   561 MIVTDEPGYY-----EDGAF---------------------GIRIENVVLVVPVKTKYNFNNRGS 599

  Fly   469 FAIVPRTVEDIEATM 483
            ....|.|:..|:..|
Human   600 LTFEPLTLVPIQTKM 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079 46/211 (22%)
PRK10879 57..483 CDD:182804 116/533 (22%)
Prolidase 195..468 CDD:238520 71/303 (23%)
XPNPEP1NP_001311062.1 Creatinase_N 53..197 CDD:304957 23/95 (24%)
Creatinase_N_2 207..369 CDD:292807 30/168 (18%)
PepP 239..609 CDD:223085 99/454 (22%)
APP 372..594 CDD:238518 70/299 (23%)
Peptidase_M24_C 600..>627 CDD:292806 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.