DRSC - DRSC Integrative Ortholog Prediction Tool

Protein Alignment Dip-C and XPNPEP3

Sequence 1:	NP_650192.1	Gene:	Dip-C / 47769	FlyBaseID:	FBgn0000455	Length:	491	Species:	Drosophila melanogaster
Sequence 2:	NP_071381.1	Gene:	XPNPEP3 / 63929	HGNCID:	28052	Length:	507	Species:	Homo sapiens

Alignment Length:	31	Identity:	12/31 - (38%)
Similarity:	15/31 - (48%)	Gaps:	9/31 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    82 SLVDDRYCEPECENCTSTPIQVHMLAIPSGL 112
            ||:|.     |.|..||.|::    |.||.|
Human    10 SLIDF-----ETEPPTSPPLE----AAPSTL 31

Gene	Sequence	Domain	Region	External ID	Identity
Dip-C	NP_650192.1	AMP_N	12..158	CDD:198079	12/31 (39%)
Dip-C	NP_650192.1	Prolidase	195..468	CDD:238520
XPNPEP3	NP_071381.1	Interaction with TNFRSF1B. /evidence=ECO:0000269\|PubMed:25609706	54..79
		AMP_N	67..210	CDD:198079
		Prolidase	252..490	CDD:238520
Blue background indicates that the domain is not in the aligned region.