DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-C and xpnpep2

DIOPT Version :9

Sequence 1:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_957326.2 Gene:xpnpep2 / 394007 ZFINID:ZDB-GENE-040426-1151 Length:703 Species:Danio rerio


Alignment Length:387 Identity:89/387 - (22%)
Similarity:132/387 - (34%) Gaps:124/387 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LLGLQEFKAMYEVDEVFYVDEMSVYLEGASPKL----ILTLSGTNSDSGLTLQPPD---FAGKEK 171
            ||.:.:.......:.:  .:|:.|||..:..:.    :|..|...:.....||.|:   :.|.| 
Zfish   292 LLSMDDIWLFVHTERI--TEELKVYLNASCYQSLCVHLLEYSSVRTYLQSYLQRPNVRVWVGTE- 353

  Fly   172 YVTDCNLLY---------------PILSECRVIKSPEEIEVLRYVAKVSSDAHIK----VMRFMR 217
            |....  ||               |:|: .:.:|...|..:|:       :||::    ||:.:.
Zfish   354 YTNQA--LYELITPEDKLLTSTYSPVLT-TKAVKDMTEQRILK-------EAHVRDAVAVMQLLL 408

  Fly   218 ------PGRMEFEGESLFLHHAYSVGGCRH-------ASYTCICGSGTNSSILHYGHAGAPNSKP 269
                  |     ||....:..|.....||.       .|:..|..||.|:::.||..:.....|.
Zfish   409 WLEKKVP-----EGAETEITAALYADQCRSKQKNSRGPSFETISASGPNAALAHYSPSNDTARKL 468

  Fly   270 VQDGDLCLFDMGANYCGYAADITCTFPANGKFTDDQKFIYNAVLDARNAVTESA-RDGVSWVDMH 333
            ..| ::.|.|.|..|.....|||.|... ||.||.||..|..||.....::.:. ..|...|.|.
Zfish   469 TVD-EMYLVDSGGQYLDGTTDITRTVHW-GKPTDFQKEAYTRVLMGNIEISRTIFPAGTRGVYME 531

  Fly   334 KLAGRVLLQRLKEGGMLKGDVEEMLEAGVSGVFQPHGLGHLIG--LDVHDVGGYLPKEPKRPSEP 396
            .|..|.|.    |.|:..|                ||.||.:|  ..||:               
Zfish   532 MLGRRALW----EVGLNYG----------------HGTGHGVGNYFGVHE--------------- 561

  Fly   397 WLSKLRFARI-LKAGMYVTIEPGCYFINWLMDRALADPNIAKFINAEMFNRFRNFGGVRIED 457
            |....:...| .:.||:.:||||.|..|                         :| |:||||
Zfish   562 WPVGFQSNNIPFQEGMFTSIEPGYYKEN-------------------------DF-GIRIED 597

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079 8/47 (17%)
PRK10879 57..483 CDD:182804 89/387 (23%)
Prolidase 195..468 CDD:238520 69/284 (24%)
xpnpep2NP_957326.2 Creatinase_N 79..209 CDD:279639
Creatinase_N_2 232..388 CDD:292807 19/101 (19%)
PepP 261..628 CDD:223085 89/387 (23%)
APP 392..611 CDD:238518 69/281 (25%)
Peptidase_M24_C 611..675 CDD:292806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.