DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-C and CG32454

DIOPT Version :9

Sequence 1:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_730740.1 Gene:CG32454 / 318037 FlyBaseID:FBgn0260481 Length:534 Species:Drosophila melanogaster


Alignment Length:474 Identity:98/474 - (20%)
Similarity:163/474 - (34%) Gaps:130/474 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VLLEGGKDQSLYNTDVDYVFRQESYFQYLFGVKEPGCYGILTIDVK--TGAQKSVLFVPRFPDEY 107
            ||:..|.|.:.     .|.|||...|.||.....||...:||...|  |||   :||:.:..|..
  Fly   124 VLVVAGADSAR-----SYPFRQRPDFLYLCDCLRPGAALVLTRSRKRNTGA---LLFLSQDVDSQ 180

  Fly   108 GTWMGELLGLQEFKAMYEVDEVF---------------YVDEMSVYLEGASPKLILTLSGTNSDS 157
            .:.:        |..|:.||:|.               :..|:..:.:.:||...:.....| ::
  Fly   181 LSTI--------FSHMHYVDDVLPLAMLKKSLLWLLRDHSPELWHFYDPSSPVSCIVQEVAN-EA 236

  Fly   158 GLTLQPPDFAGKEKYVTDCNLLYPILSECRVIKSPEEIEVLRYVAKVSSDAHIKVMRFMRPGRME 222
            .:.:      |..:|         ||...|.:|:..|:..||.....::|:..:|          
  Fly   237 KIPM------GNPRY---------ILQYTRTVKTSRELRALRRANATAADSMAEV---------- 276

  Fly   223 FEGESLFLHHAYSVGGCRHASYTCICGSGTNSSILHYGHAGAPNSKPVQDGD-LCLFDMGANYCG 286
                 :..||...........|.|         .|.:.......:....||: |...|.|..|.|
  Fly   277 -----IAQHHQIPQELAASFDYKC---------RLRHARPDVTKTSCGLDGNGLWQMDAGCQYGG 327

  Fly   287 YAADITCTFPANGKFTDDQKFIYNAVLDAR----NAVTESARDGV--SWVDMHKLAGRVLLQRLK 345
            |...:...:|::|:||..||.||.|:||.|    :.:..:..:|.  :.:::|.....:|.:.|:
  Fly   328 YEGGLARCWPSSGRFTPPQKMIYGALLDMRRDLCSLIQYAGCEGAVRTPLELHAAYLILLARHLR 392

  Fly   346 EGGML-KG--DVEEMLEAGVSGVFQPHGLGHLIGLDVHDVGGYLPKEPKRPSEPWLSKLRFARIL 407
            |..:| ||  ...|.:|........|..:.| :||...|....|...|..|          ..::
  Fly   393 ELRVLPKGVSSAAETVELARKYNCSPVVVSH-VGLGKRDTSRRLLDYPFAP----------GNVM 446

  Fly   408 KAGMYVTIEPGCYFINWLMDRALADPNIAKFINAEMFNRFRNF-----GGVRIEDDV---LITKT 464
            ...:.::|...|                     .:.:..||..     ..:.:.||.   |:|  
  Fly   447 SLRLSISIPDDC---------------------CQAYPEFRGILCQLGDTLHVRDDYSVDLLT-- 488

  Fly   465 GVENFAIVPRTVEDIEATM 483
                 |..|...:|||..:
  Fly   489 -----AACPSEPQDIEVCL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079 31/129 (24%)
PRK10879 57..483 CDD:182804 94/460 (20%)
Prolidase 195..468 CDD:238520 55/290 (19%)
CG32454NP_730740.1 Creatinase_N 106..223 CDD:304957 28/114 (25%)
APP_MetAP 259..468 CDD:294199 51/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D200485at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.