DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-C and Fastkd1

DIOPT Version :9

Sequence 1:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001178667.1 Gene:Fastkd1 / 311112 RGDID:1563531 Length:832 Species:Rattus norvegicus


Alignment Length:229 Identity:51/229 - (22%)
Similarity:88/229 - (38%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 EGASPKLILTLSGTNSDSGLTLQPPDFAGKEKYVTDCNLLYPILSECRVIKSPEEIEVLRYVAKV 204
            |..|.:..||:.|...|    ::..|....:|.|   ::||..|..|:.::..:.|:.|.::...
  Rat   320 EELSSQQALTVLGAMED----MESRDSHLIKKIV---SVLYRHLDNCKSVELLKIIQALTFLHFQ 377

  Fly   205 SSDAHIKVMRFMRPGRMEFE---GESLFLHHAYSVGGCRHASYTCICGSGTNSSILHYGHAGAP- 265
            |.:..:| :|.:...|:|..   .|...|..|.|:....|.:.|.:..:.|   :|       | 
  Rat   378 SKELFMK-LREVLLSRLEASVTPSEVSVLVSALSMLPYPHLNETALSRTET---VL-------PQ 431

  Fly   266 -NSKPVQDGDLCLFDMGANYCGYAADITCTFPANGKFTD-DQKFIYNAVLD--ARNAVTESARDG 326
             :.:.:.|..:||.....|      |..|:....||..| .||      ||  ....:.:|....
  Rat   432 CDFRELSDLVVCLMRWIQN------DHLCSASTAGKQLDLLQK------LDHWGHRRLQQSTSLD 484

  Fly   327 VSWVDMHKLAGRVLLQRLKEGGMLKGDVEEMLEA 360
            :.|.::..:.|..|.:.|         |||.:.|
  Rat   485 LLWEELKSVKGEWLHESL---------VEESITA 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079 6/17 (35%)
PRK10879 57..483 CDD:182804 51/229 (22%)
Prolidase 195..468 CDD:238520 38/174 (22%)
Fastkd1NP_001178667.1 FAST_1 560..628 CDD:284217
FAST_2 648..729 CDD:285557
RAP 766..824 CDD:214932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.