DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-C and Fastkd3

DIOPT Version :9

Sequence 1:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001076043.1 Gene:Fastkd3 / 290946 RGDID:1309729 Length:656 Species:Rattus norvegicus


Alignment Length:95 Identity:20/95 - (21%)
Similarity:40/95 - (42%) Gaps:16/95 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 EVDEVFYVDEMSVYLEGASPKLI-LTLSGTNSDSGLTLQPPDFAGKEKYVTDCNLLYPILSECRV 188
            ||..:..:.|....|:|||.::: |.:....|::..|..|.|...          :|.||..|  
  Rat   210 EVHHLCVLGESLARLQGASCEILKLVICQLQSENLETFAPEDIVS----------VYRILQAC-- 262

  Fly   189 IKSPEEIEVLRYVAKVSSDAHIKVMRFMRP 218
               |||::..:......::..:.::.::.|
  Rat   263 ---PEEVDKHQTFLNTVNNFSLSIVSYLSP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079 9/33 (27%)
PRK10879 57..483 CDD:182804 20/95 (21%)
Prolidase 195..468 CDD:238520 1/24 (4%)
Fastkd3NP_001076043.1 FAST_1 405..473 CDD:284217
FAST_2 489..575 CDD:285557
RAP 589..646 CDD:214932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D352329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.