DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-C and pid-5

DIOPT Version :9

Sequence 1:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_504162.2 Gene:pid-5 / 178819 WormBaseID:WBGene00021555 Length:1061 Species:Caenorhabditis elegans


Alignment Length:335 Identity:72/335 - (21%)
Similarity:131/335 - (39%) Gaps:87/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KAMYEVDEVFY------VDEMSVYLEGASPKLILTLSGTNS---DSGLTLQPPDFAGKEKYV--- 173
            |.:.:|.:.::      ||:    .:.|||.:...:|.|.|   |..:.:.|     :..|:   
 Worm   689 KRLNDVSKAYFARQSIDVDD----YKAASPYIYDWISATKSSFADKKILISP-----ETNYLIGR 744

  Fly   174 ---TDCNLLYP-ILSECRVIKSPEEIEVLRYVAKVSSDAHIKVMRFMRPGRMEFEGESLFLHHAY 234
               .|.:::.| |:...:.||:.::::.:|  |....|: |.::.|:  .:.|.|....:....|
 Worm   745 LIGEDHSMIDPSIMERIKKIKNTDQLKGMR--ASNLRDS-IAIVEFL--CKFEKERRDGYTFTEY 804

  Fly   235 SVGG------CRHASY-----TCICGSGTNSSILHYGHAGAPNS-KPVQDGDLCLFDMGANYCGY 287
            .:..      .|:..|     ..|..:|.:||:    ||..|:: |.|......:|..|::|...
 Worm   805 ELAADIEEVKTRNREYIGLKQPTIFSAGEHSSV----HAHRPDAQKIVFHYQQFMFQTGSHYTDG 865

  Fly   288 AADITCT----FPANGKFTDDQKFIYNAVLDARNAVTESARDGVSWVDMH-KLAGRVLLQRLKEG 347
            |.:...|    :|     |::....|..||..                 | :||.....:.|..|
 Worm   866 ATNCARTIWDSYP-----TEEFMNQYTLVLKG-----------------HIRLASASFPKTLTYG 908

  Fly   348 GMLKGDVEEMLEAGVSGVFQPHGLGHLIG--LDVHDVGGYLPKEPKRPSEPWLSKLRFARILKAG 410
            ..|  |:...:....:|:...|..||.:|  |::.|....:.:||...:.          |::||
 Worm   909 SRL--DIFARIALWDAGLDYDHETGHSVGHFLNIRDTQIVIGREPYSSNS----------IIEAG 961

  Fly   411 MYVTIEPGCY 420
            ..:|||||.|
 Worm   962 QVMTIEPGYY 971

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079 11/45 (24%)
PRK10879 57..483 CDD:182804 72/335 (21%)
Prolidase 195..468 CDD:238520 54/245 (22%)
pid-5NP_504162.2 Creatinase_N 499..606 CDD:304957
PepP 630..984 CDD:223085 72/335 (21%)
Creatinase_N_2 630..766 CDD:292807 17/85 (20%)
APP 772..996 CDD:238518 54/243 (22%)
Peptidase_M24_C 998..1061 CDD:292806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0006
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.