DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and Atf4

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_077379.1 Gene:Atf4 / 79255 RGDID:621863 Length:347 Species:Rattus norvegicus


Alignment Length:395 Identity:99/395 - (25%)
Similarity:136/395 - (34%) Gaps:136/395 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NFANGITLIG------DDEALTLEEVASLQLLSDEEMVVEIFDLKDEECLLDQKATLNCIDYDSN 111
            :|.|...|.|      |...|..||  ||.||.|   .:|:                      :.
  Rat     5 SFLNSEVLAGDLMSPFDQSGLGAEE--SLGLLDD---YLEV----------------------AK 42

  Fly   112 SFQPNINVITQAIVPANKVQFGASSDAA---------SLPSAADYQLND---GPSLILQQLTPPQ 164
            .|:|:                |.|||.|         .|.||:|....|   |...:|:::...:
  Rat    43 HFKPH----------------GFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKE 91

  Fly   165 SPPQFDAYKQAGDAQ--PKPVLVKAEQKVQCYTP---------------------DVTHAASATP 206
            .  .|||..:..|.:  |..:|...:.....:.|                     .|.....|.|
  Rat    92 F--DFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAP 154

  Fly   207 FNFTNWVGGS--------------EIARENQLVDDIVNMRAKELELSTNWQQLNEDCESQASSSL 257
            |.|...:..|              |:..|   ||.....|..:   |..:..|...|..:..:..
  Rat   155 FTFLQPLPCSPGFLSSTPDHSFSLELGSE---VDISEGDRKPD---SAAYITLTPQCVKEEDTPS 213

  Fly   258 DSRSTGSGVCSSIADADEDWVPELI------SSSSSPAPTTIEQSASQPK-KRTRTYG-RGVE-- 312
            ||   .||:|.|         ||..      |.|:|.||.....|...|: .|.:.|. .||.  
  Rat   214 DS---DSGICMS---------PESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVT 266

  Fly   313 --------DRKIRKKEQNKNAATRYRQKKKLEMENVLGEEHVLSKENEQLRRTLQERHNEMRYLR 369
                    |:|::|.||||.|||||||||:.|.|.:.||...|.|:||.|:........|::||:
  Rat   267 AKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLK 331

  Fly   370 QLIRE 374
            .||.|
  Rat   332 DLIEE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 30/60 (50%)
coiled coil 315..374 CDD:269840 29/58 (50%)
Atf4NP_077379.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..296 35/105 (33%)
BetaTrCP degron motif. /evidence=ECO:0000250|UniProtKB:P18848 213..222 5/11 (45%)
bZIP_ATF4 275..337 CDD:269840 31/62 (50%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 276..296 14/19 (74%)
coiled coil 277..328 CDD:269840 25/50 (50%)
Interaction with GABBR1. /evidence=ECO:0000269|PubMed:10924501 301..337 13/36 (36%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 302..330 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10325
eggNOG 1 0.900 - - E1_KOG4571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002572
OrthoInspector 1 1.000 - - otm44439
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13044
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.