DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and atf4b

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001096662.1 Gene:atf4b / 556410 ZFINID:ZDB-GENE-070928-23 Length:425 Species:Danio rerio


Alignment Length:369 Identity:95/369 - (25%)
Similarity:144/369 - (39%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 DLFPLTDSNDTEWLYDDNFANGITLIGDDEALTLEEVASLQLLSDEEMVVEIFDLKDEECLLDQK 100
            ||..|.||.|:|               |..:...|.:|||    :.::.:|...:..:.......
Zfish   120 DLESLIDSYDSE---------------DPPSSPEELIASL----ESQIDLESLPVASDNTSPSPS 165

  Fly   101 ATLNCIDYDSN-SFQPNINVIT-------------QAIVPANKVQFGASSDAAS-LPSAADYQLN 150
            |::..||..|| ||..|..|.|             .::||..:.:|...|:.|| :||       
Zfish   166 ASVPEIDQLSNLSFTLNTPVTTHLIPPSPCEILDSSSVVPEPQAEFEIKSEPASPVPS------- 223

  Fly   151 DGPSLILQQLTPPQSPP---QFDAYKQAGDAQ-PKPVLVKAEQKVQCYTPDVTHAASATPFNFTN 211
              ||::     ||:||.   :........:.| |.||.::..:.|...:|               
Zfish   224 --PSVL-----PPESPTDTLELGCEVDIAEVQSPSPVELRVPKFVLSLSP--------------- 266

  Fly   212 WVGGSEIARENQLVDDIVNMRAKELELSTNWQQLNE-DCESQASSSLDSRSTGSGVCSSIADA-- 273
                          ..||.:.|.:.|::.......| ..||..|.:.....|.|...|..:.|  
Zfish   267 --------------TRIVFVLAPKEEVNAMATHSGEVVVESSPSPTFSEPKTPSCPPSRSSRAKP 317

  Fly   274 --DEDWVPELISSSSSPAPTTIEQSASQPKKRTRTYGRGVEDRKIRKKEQNKNAATRYRQKKKLE 336
              ..|:.......|.||..|...:|||..|.       .||.:|::|.||||.|||||||||:.|
Zfish   318 YLSHDFKTTKNQQSESPTLTGRVKSASGSKV-------VVEKKKLKKMEQNKTAATRYRQKKRAE 375

  Fly   337 MENVLGEEHVLSKENEQLRRTLQERHNEMRYLRQLIREFYHERK 380
            .|.:|.|..||.:.|::|....:....|::||::|:.|....|:
Zfish   376 QETLLSECAVLEERNQELAEKAESLTKEIQYLKELMEEVKRARE 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 27/60 (45%)
coiled coil 315..374 CDD:269840 27/58 (47%)
atf4bNP_001096662.1 bZIP_ATF4 358..414 CDD:269840 25/55 (45%)
coiled coil 358..413 CDD:269840 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10831
eggNOG 1 0.900 - - E1_KOG4571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002572
OrthoInspector 1 1.000 - - otm24549
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13044
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5457
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.