DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and atf5.2

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001006821.1 Gene:atf5.2 / 448546 XenbaseID:XB-GENE-5902427 Length:305 Species:Xenopus tropicalis


Alignment Length:264 Identity:60/264 - (22%)
Similarity:100/264 - (37%) Gaps:69/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PSAADYQLNDGPSLILQQLTPPQSPPQFDAY---KQAGDAQPKPVLVKAEQKVQCYTPD-VTHAA 202
            |||.|.::.  .:|:.::|      .|.:.|   :....:||.|    .:|...|..|. ..|..
 Frog    82 PSAPDLEIM--ATLLKKEL------EQMEDYFLEETVSPSQPTP----PDQVAPCTPPSHEVHFL 134

  Fly   203 SATPFNFTNWVGGSEIARENQLVDDIVNMRAKELELSTNWQQLNEDCESQASSSLDSRSTGSGVC 267
            ..||   .:..||||:..::                     .:.|:....|.:||::..:|   |
 Frog   135 FPTP---DHQFGGSEVEFQD---------------------YVEEETPPPAPASLETLDSG---C 172

  Fly   268 SSI----ADADEDW----------------VPELISSSSSPAPTTIEQSASQPKKRTRTYGRGVE 312
            ..:    :|...|:                .||.:...:.|.|      ..:|........|...
 Frog   173 LELLNLYSDVPSDFHREQLQDLSVTKDTTDPPEFLKQLNRPTP------YDRPSSSCSVLPRQKG 231

  Fly   313 DRKIRKKEQNKNAATRYRQKKKLEMENVLGEEHVLSKENEQLRRTLQERHNEMRYLRQLIREFYH 377
            |||.:|::|||.||.||||:|:.|.:.:..|...|...|..|:........|::|::.|:.|.|.
 Frog   232 DRKQKKRDQNKTAALRYRQRKRAEYDALDDECQSLEVRNRDLKEKSDSIEREIQYVKDLLIEVYK 296

  Fly   378 ERKR 381
            .|.:
 Frog   297 ARSQ 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 22/60 (37%)
coiled coil 315..374 CDD:269840 20/58 (34%)
atf5.2NP_001006821.1 bZIP_ATF4 232..294 CDD:269840 22/61 (36%)
coiled coil 234..293 CDD:269840 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10682
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5170
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002572
OrthoInspector 1 1.000 - - otm47487
Panther 1 1.100 - - O PTHR13044
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.150

Return to query results.
Submit another query.