DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and atf4a

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_998398.1 Gene:atf4a / 406514 ZFINID:ZDB-GENE-040426-2340 Length:339 Species:Danio rerio


Alignment Length:408 Identity:96/408 - (23%)
Similarity:146/408 - (35%) Gaps:134/408 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WDLKMEPQSP-------TSVLGSDLFPLTDSNDTEWLYDDNFANGITLIGDDEALTLEEVASLQL 77
            |.|..:||.|       :|||.....|.:.|.       .:|:...:.....|.|:|....|..|
Zfish    16 WPLTADPQGPLLDQDEESSVLEGSWSPSSSSL-------SSFSPPASGDAPSELLSLSWQPSDVL 73

  Fly    78 LSDEEMVVEIFDLKDEECLLDQKATLNCIDYDSNSFQPNINVITQAIVPANKVQFGASSDAA--- 139
            |:::....::|...|   .:.:|..||..|.||     .|........|.:.....|..|::   
Zfish    74 LTEQSTAGDVFPGMD---WMTEKLDLNDFDLDS-----LIGSCDSEDSPGSPEDLLACLDSSMDL 130

  Fly   140 ---SLP-SAADYQLNDGPSLILQQ-------------LTPPQSPPQFDAYKQAGDAQPKPVLVKA 187
               ||| .:||..|..|..|.|.:             .:||:..|| |.:.:.....|..:::  
Zfish   131 DLDSLPFGSADLDLPLGLDLPLPEEIKSEPLSPAPSVPSPPEEAPQ-DEHTEVPVLHPAGIML-- 192

  Fly   188 EQKVQCYTPDVTHAASATPFNFTNWVGGSEIARENQLVDDIVNMRAKELELSTNWQQLNEDCESQ 252
                           |.:|.:.                  :|.:..||       :|...||   
Zfish   193 ---------------SLSPSHI------------------VVLLTPKE-------EQNISDC--- 214

  Fly   253 ASSSLDSRSTGSGVCSSIADADEDWVPELISSSSSPAPTTIEQSASQPKKRTRTYGR-------- 309
                              :|:|..     ||.|.|||    .||..:|..|.:.|.|        
Zfish   215 ------------------SDSDSG-----ISVSGSPA----HQSDLEPSSRAKPYSRPDPEASPA 252

  Fly   310 ---------GVE--DRKIRKKEQNKNAATRYRQKKKLEMENVLGEEHVLSKENEQLRRTLQERHN 363
                     |..  ::|::|.||||.|||||||||::|.|::..|...|.|:|.:|.........
Zfish   253 LKGRVKTSSGAPKVEKKLKKMEQNKTAATRYRQKKRVEQESLNSECSELEKKNRELSEKADSLSR 317

  Fly   364 EMRYLRQLIREFYHERKR 381
            |::|||.|:.|....::|
Zfish   318 EIQYLRDLLEEMRTAKQR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 27/60 (45%)
coiled coil 315..374 CDD:269840 27/58 (47%)
atf4aNP_998398.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..62 11/52 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..182 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..313 40/133 (30%)
bZIP_ATF4 267..329 CDD:269840 27/61 (44%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 268..288 14/19 (74%)
coiled coil 269..328 CDD:269840 27/58 (47%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 294..322 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10831
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002572
OrthoInspector 1 1.000 - - otm24549
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13044
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5457
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.130

Return to query results.
Submit another query.