DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and Atf5

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_758839.3 Gene:Atf5 / 282840 RGDID:628902 Length:281 Species:Rattus norvegicus


Alignment Length:100 Identity:36/100 - (36%)
Similarity:52/100 - (52%) Gaps:13/100 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 ISSSSSPAPTTIEQSASQPKKRTRTYGRGVEDRKIRKKEQNKNAATRYRQKKKLEMENVLGEEHV 346
            :.|.|.|||.....|.           ||  |||.:|::|||:||.||||:|:.|.|.:.||...
  Rat   190 LPSPSRPAPYPSPAST-----------RG--DRKQKKRDQNKSAALRYRQRKRAEGEALEGECQG 241

  Fly   347 LSKENEQLRRTLQERHNEMRYLRQLIREFYHERKR 381
            |...|.:||...:....|::|::.|:.|.|..|.:
  Rat   242 LEARNRELRERAESVEREIQYVKDLLIEVYKARSQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 25/60 (42%)
coiled coil 315..374 CDD:269840 23/58 (40%)
Atf5NP_758839.3 Required for protein stabilization induced by IL1B. /evidence=ECO:0000250|UniProtKB:Q9Y2D1 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..152
Interaction with PTP4A1. /evidence=ECO:0000250|UniProtKB:O70191 119..216 12/38 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..236 24/58 (41%)
bZIP_ATF4 208..270 CDD:269840 25/61 (41%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 209..229 12/19 (63%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 235..249 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10325
eggNOG 1 0.900 - - E1_KOG4571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002572
OrthoInspector 1 1.000 - - otm44439
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13044
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.