DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and ATF5

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001180575.1 Gene:ATF5 / 22809 HGNCID:790 Length:282 Species:Homo sapiens


Alignment Length:115 Identity:39/115 - (33%)
Similarity:60/115 - (52%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 CSSIADADEDWVPELISSSSSPAPTTIEQSASQPKKRTRTYGRGVEDRKIRKKEQNKNAATRYRQ 331
            |.:.|..:|..:|.|......|.|:..:.|...|.....| .||  |||.:|::|||:||.||||
Human   166 CRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPYPHPAT-TRG--DRKQKKRDQNKSAALRYRQ 227

  Fly   332 KKKLEMENVLGEEHVLSKENEQLRRTLQERHNEMRYLRQLIREFYHERKR 381
            :|:.|.|.:.||...|...|.:|:...:....|::|::.|:.|.|..|.:
Human   228 RKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 24/60 (40%)
coiled coil 315..374 CDD:269840 22/58 (38%)
ATF5NP_001180575.1 Required for protein stabilization induced by IL1B. /evidence=ECO:0000269|PubMed:24379400 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..152
Interaction with PTP4A1 119..217 16/53 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..238 26/67 (39%)
bZIP_ATF4 209..271 CDD:269840 24/61 (39%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 210..230 12/19 (63%)
coiled coil 211..270 CDD:269840 22/58 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 236..250 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10596
eggNOG 1 0.900 - - E1_KOG4571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002572
OrthoInspector 1 1.000 - - otm40311
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13044
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5457
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.