DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and zip-5

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_506292.1 Gene:zip-5 / 183204 WormBaseID:WBGene00007932 Length:216 Species:Caenorhabditis elegans


Alignment Length:175 Identity:43/175 - (24%)
Similarity:74/175 - (42%) Gaps:37/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 ELSTNWQQLNEDCESQASSSLD------SRSTGSGVCSSIADADEDWVPELI--SSSSSPAPTTI 293
            |.|..:|:||::..|..|.:.:      .|.:|:...|:.:|..:|   |.:  |:......|..
 Worm    21 EPSPKYQKLNKNIFSPLSPTFELKFQSKLRVSGNSTSSTTSDDSDD---ESLHRSNQLKHLETLF 82

  Fly   294 EQSASQPKKRTRTYGRGVE----DRKI-------RKKEQNKNAATRYRQKKKLEMENVLGEEHVL 347
            ::|.    .||.....||.    |.|:       :|:.:|..||.|.|:|.|.:.:::..|...|
 Worm    83 KESI----LRTSFSRPGVSNTSCDEKLDLVSEDEKKRLRNTEAARRCREKIKRKTDDLETELTRL 143

  Fly   348 SKENEQLR----RTLQERHNEMRYLR-------QLIREFYHERKR 381
            :..||.:.    |.|.:...:||.|.       :|..|..:|.|:
 Worm   144 TARNEVMNQHRIRLLSQVEEQMRMLENIKSRNPELEAEIRYEAKK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 20/78 (26%)
coiled coil 315..374 CDD:269840 19/76 (25%)
zip-5NP_506292.1 SMC_prok_B <101..>205 CDD:274008 23/88 (26%)
bZIP 112..162 CDD:269834 14/49 (29%)
coiled coil 112..162 CDD:269834 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13044
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.