DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and atf-4

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_510456.1 Gene:atf-4 / 181576 WormBaseID:WBGene00000221 Length:208 Species:Caenorhabditis elegans


Alignment Length:146 Identity:43/146 - (29%)
Similarity:70/146 - (47%) Gaps:33/146 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 NMRAKELELSTNWQQLNEDCESQASSSLDSRSTGSGVCSSIADADEDWVPELISSSSSPAPT-TI 293
            |::|||..|    :::..:||     .::.||                     :||:|||.. :.
 Worm    87 NVQAKEQIL----EEIVRECE-----EIERRS---------------------NSSASPASNWSS 121

  Fly   294 EQSASQPKKRTRTYGRGVEDRKIRKKEQNKNAATRYRQKKKLEMENVLGEEHVLSKENEQLRRTL 358
            ::..||.:|....|  ...::|.|||.||:.||||||:||:.|.|..:.....||..|.:|:..:
 Worm   122 DEHDSQSEKSYHPY--KTPEKKERKKAQNRLAATRYREKKRREKEEAMTCIEGLSVTNGKLKDQV 184

  Fly   359 QERHNEMRYLRQLIRE 374
            .|...|:||.::.:.|
 Worm   185 SELEREIRYFKKFMTE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 24/60 (40%)
coiled coil 315..374 CDD:269840 24/58 (41%)
atf-4NP_510456.1 bZIP_ATF4 139..201 CDD:269840 25/62 (40%)
coiled coil 141..192 CDD:269840 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002572
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_122621
Panther 1 1.100 - - LDO PTHR13044
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.860

Return to query results.
Submit another query.