Sequence 1: | NP_001260672.1 | Gene: | crc / 47767 | FlyBaseID: | FBgn0000370 | Length: | 381 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500318.1 | Gene: | zip-11 / 177099 | WormBaseID: | WBGene00021082 | Length: | 228 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 92/199 - (46%) | Gaps: | 40/199 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 QCY--------TPDVTHAASATPFNFTNWVGGSEIARENQLVD-DIVNMR--AKEL--ELSTNWQ 243
Fly 244 QLNEDCESQASSSLDSRSTGSGVCSSIADADEDWVPELISSSSSPAPTTIE---QSASQPKKRTR 305
Fly 306 TYGRGVEDRKI--RKKEQNKNAATRYRQKKKLEMENVLGEEHVLSKENEQLRRTLQERH--NEMR 366
Fly 367 YLRQ 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
crc | NP_001260672.1 | bZIP_ATF4 | 313..374 | CDD:269840 | 22/62 (35%) |
coiled coil | 315..374 | CDD:269840 | 22/60 (37%) | ||
zip-11 | NP_500318.1 | bZIP_ATF4 | 166..224 | CDD:269840 | 21/56 (38%) |
coiled coil | 166..215 | CDD:269840 | 19/50 (38%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4571 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |