DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment crc and zip-11

DIOPT Version :9

Sequence 1:NP_001260672.1 Gene:crc / 47767 FlyBaseID:FBgn0000370 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_500318.1 Gene:zip-11 / 177099 WormBaseID:WBGene00021082 Length:228 Species:Caenorhabditis elegans


Alignment Length:199 Identity:47/199 - (23%)
Similarity:92/199 - (46%) Gaps:40/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QCY--------TPDVTHAASATPFNFTNWVGGSEIARENQLVD-DIVNMR--AKEL--ELSTNWQ 243
            :||        .|..|...::.|.::.: :|.::::.:....: |.|:.|  .||:  |.|..::
 Worm    41 ECYQTLSCPSDLPVETSYYNSVPPSYQD-LGQTDLSPQFWCAEVDCVHERCSTKEIPHEQSKIFE 104

  Fly   244 QLNEDCESQASSSLDSRSTGSGVCSSIADADEDWVPELISSSSSPAPTTIE---QSASQPKKRTR 305
            :::::|:...:|        :|.|.......|:...|.|     |....::   |:....||.  
 Worm   105 EISKECDHIMNS--------AGDCEKCQVEHENGAQEAI-----PINDLVDIVMQTVDNLKKE-- 154

  Fly   306 TYGRGVEDRKI--RKKEQNKNAATRYRQKKKLEMENVLGEEHVLSKENEQLRRTLQERH--NEMR 366
              |...::.|:  ||::|||.||.|||.|:|.:.:::|.:.......|::|:  ||..|  .|:.
 Worm   155 --GSSNDETKLLSRKRQQNKVAAARYRDKQKAKWQDLLDQLEAEEDRNQRLK--LQAGHLEKEVA 215

  Fly   367 YLRQ 370
            .:||
 Worm   216 EMRQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
crcNP_001260672.1 bZIP_ATF4 313..374 CDD:269840 22/62 (35%)
coiled coil 315..374 CDD:269840 22/60 (37%)
zip-11NP_500318.1 bZIP_ATF4 166..224 CDD:269840 21/56 (38%)
coiled coil 166..215 CDD:269840 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.